Brand: | Abnova |
Reference: | H00004199-M01 |
Product name: | ME1 monoclonal antibody (M01), clone 2A2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ME1. |
Clone: | 2A2 |
Isotype: | IgG2b Kappa |
Gene id: | 4199 |
Gene name: | ME1 |
Gene alias: | HUMNDME|MES |
Gene description: | malic enzyme 1, NADP(+)-dependent, cytosolic |
Genbank accession: | BC025246 |
Immunogen: | ME1 (AAH25246, 1 a.a. ~ 572 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ |
Protein accession: | AAH25246 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (88.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged ME1 is approximately 1ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |