| Brand: | Abnova |
| Reference: | H00004190-M01 |
| Product name: | MDH1 monoclonal antibody (M01), clone 2B11-B7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MDH1. |
| Clone: | 2B11-B7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4190 |
| Gene name: | MDH1 |
| Gene alias: | MDH-s|MDHA|MGC:1375|MOR2 |
| Gene description: | malate dehydrogenase 1, NAD (soluble) |
| Genbank accession: | BC001484 |
| Immunogen: | MDH1 (AAH01484.1, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA |
| Protein accession: | AAH01484.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MDH1 is approximately 3ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |