| Brand: | Abnova |
| Reference: | H00004189-M09 |
| Product name: | DNAJB9 monoclonal antibody (M09), clone 3G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DNAJB9. |
| Clone: | 3G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4189 |
| Gene name: | DNAJB9 |
| Gene alias: | DKFZp564F1862|ERdj4|MDG1|MST049|MSTP049 |
| Gene description: | DnaJ (Hsp40) homolog, subfamily B, member 9 |
| Genbank accession: | NM_012328 |
| Immunogen: | DNAJB9 (NP_036460.1, 114 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ |
| Protein accession: | NP_036460.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DNAJB9 is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | The unfolded protein response governs integrity of the haematopoietic stem-cell pool during stress.van Galen P, Kreso A, Mbong N, Kent DG, Fitzmaurice T, Chambers JE, Xie S, Laurenti E, Hermans K, Eppert K, Marciniak SJ, Goodall JC, Green AR, Wouters BG, Wienholds E, Dick JE Nature. 2014 Apr 28. doi: 10.1038/nature13228. |