Brand: | Abnova |
Reference: | H00004179-M14A |
Product name: | CD46 monoclonal antibody (M14A), clone 1B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MCP. |
Clone: | 1B6 |
Isotype: | IgM Kappa |
Gene id: | 4179 |
Gene name: | CD46 |
Gene alias: | MCP|MGC26544|MIC10|TLX|TRA2.10 |
Gene description: | CD46 molecule, complement regulatory protein |
Genbank accession: | BC030594 |
Immunogen: | CD46 (AAH30594, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIG |
Protein accession: | AAH30594 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CD46 monoclonal antibody (M14A), clone 1B6. Western Blot analysis of CD46 expression in HL-60. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |