| Brand: | Abnova |
| Reference: | H00004179-M14A |
| Product name: | CD46 monoclonal antibody (M14A), clone 1B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MCP. |
| Clone: | 1B6 |
| Isotype: | IgM Kappa |
| Gene id: | 4179 |
| Gene name: | CD46 |
| Gene alias: | MCP|MGC26544|MIC10|TLX|TRA2.10 |
| Gene description: | CD46 molecule, complement regulatory protein |
| Genbank accession: | BC030594 |
| Immunogen: | CD46 (AAH30594, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIG |
| Protein accession: | AAH30594 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CD46 monoclonal antibody (M14A), clone 1B6. Western Blot analysis of CD46 expression in HL-60. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |