View larger

MCM4 monoclonal antibody (M01), clone 1A6

Reference:

Condition: New product

Data sheet of MCM4 monoclonal antibody (M01), clone 1A6

Brand:	Abnova
Reference:	H00004173-M01
Product name:	MCM4 monoclonal antibody (M01), clone 1A6
Product description:	Mouse monoclonal antibody raised against a partial recombinant MCM4.
Clone:	1A6
Isotype:	IgG2a Kappa
Gene id:	4173
Gene name:	MCM4
Gene alias:	CDC21\|CDC54\|MGC33310\|P1-CDC21\|hCdc21
Gene description:	minichromosome maintenance complex component 4
Genbank accession:	BC031061
Immunogen:	MCM4 (AAH31061, 267 a.a. ~ 366 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	KTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQT
Protein accession:	AAH31061
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:	http://www.abnova.com/application_image/
Application image note:	Detection limit for recombinant GST tagged MCM4 is approximately 10ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice