Brand: | Abnova |
Reference: | H00004172-M06 |
Product name: | MCM3 monoclonal antibody (M06), clone 3E11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MCM3. |
Clone: | 3E11 |
Isotype: | IgG2a Kappa |
Gene id: | 4172 |
Gene name: | MCM3 |
Gene alias: | HCC5|MGC1157|P1-MCM3|P1.h|RLFB |
Gene description: | minichromosome maintenance complex component 3 |
Genbank accession: | NM_002388 |
Immunogen: | MCM3 (NP_002379, 26 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVS |
Protein accession: | NP_002379 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MCM3 monoclonal antibody (M06), clone 3E11. Western Blot analysis of MCM3 expression in human spleen. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |