MCM3 monoclonal antibody (M06), clone 3E11 View larger

MCM3 monoclonal antibody (M06), clone 3E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCM3 monoclonal antibody (M06), clone 3E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about MCM3 monoclonal antibody (M06), clone 3E11

Brand: Abnova
Reference: H00004172-M06
Product name: MCM3 monoclonal antibody (M06), clone 3E11
Product description: Mouse monoclonal antibody raised against a full-length recombinant MCM3.
Clone: 3E11
Isotype: IgG2a Kappa
Gene id: 4172
Gene name: MCM3
Gene alias: HCC5|MGC1157|P1-MCM3|P1.h|RLFB
Gene description: minichromosome maintenance complex component 3
Genbank accession: NM_002388
Immunogen: MCM3 (NP_002379, 26 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVS
Protein accession: NP_002379
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004172-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004172-M06-2-A4-1.jpg
Application image note: MCM3 monoclonal antibody (M06), clone 3E11. Western Blot analysis of MCM3 expression in human spleen.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MCM3 monoclonal antibody (M06), clone 3E11 now

Add to cart