No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00004172-M01A |
| Product name: | MCM3 monoclonal antibody (M01A), clone 4F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MCM3. |
| Clone: | 4F7 |
| Isotype: | IgG2a Lambda |
| Gene id: | 4172 |
| Gene name: | MCM3 |
| Gene alias: | HCC5|MGC1157|P1-MCM3|P1.h|RLFB |
| Gene description: | minichromosome maintenance complex component 3 |
| Genbank accession: | NM_002388 |
| Immunogen: | MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI |
| Protein accession: | NP_002379 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | MCM3 monoclonal antibody (M01A), clone 4F7. Western Blot analysis of MCM3 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |