| Brand: | Abnova |
| Reference: | H00004171-Q01 |
| Product name: | MCM2 (Human) Recombinant Protein (Q01) |
| Product description: | Human MCM2 partial ORF ( AAH07670, 805 a.a. - 904 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 4171 |
| Gene name: | MCM2 |
| Gene alias: | BM28|CCNL1|CDCL1|D3S3194|KIAA0030|MGC10606|MITOTIN|cdc19 |
| Gene description: | minichromosome maintenance complex component 2 |
| Genbank accession: | BC007670 |
| Immunogen sequence/protein sequence: | TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF |
| Protein accession: | AAH07670 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The selection and characterization of antibodies to minichromosome maintenance proteins that highlight cervical dysplasia.Henderson D, Hall L, Prpic N, Hessling J, Parker M, Sampson S, Simkins S, Brough G, Dixon E, Lenz K, Knapp S, Murphy P, Taylor A, Fischer T, Malinowski DP. J Immunol Methods. 2011 May 12. [Epub ahead of print] |