MBD1 monoclonal antibody (M05J), clone 2B10 View larger

MBD1 monoclonal antibody (M05J), clone 2B10

New product

504,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MBD1 monoclonal antibody (M05J), clone 2B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MBD1 monoclonal antibody (M05J), clone 2B10

Brand: Abnova
Reference: H00004152-M05J
Product name: MBD1 monoclonal antibody (M05J), clone 2B10
Product description: Mouse monoclonal antibody raised against a partial recombinant MBD1.
Clone: 2B10
Isotype: IgG2b Kappa
Gene id: 4152
Gene name: MBD1
Gene alias: CXXC3|PCM1|RFT
Gene description: methyl-CpG binding domain protein 1
Genbank accession: NM_015846
Immunogen: MBD1 (NP_056671, 415 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
Protein accession: NP_056671
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004152-M05J-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004152-M05J-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged MBD1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MBD1 monoclonal antibody (M05J), clone 2B10 now

Add to cart