No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00004152-M02 |
| Product name: | MBD1 monoclonal antibody (M02), clone 2C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MBD1. |
| Clone: | 2C7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4152 |
| Gene name: | MBD1 |
| Gene alias: | CXXC3|PCM1|RFT |
| Gene description: | methyl-CpG binding domain protein 1 |
| Genbank accession: | NM_015846 |
| Immunogen: | MBD1 (NP_056671, 415 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE |
| Protein accession: | NP_056671 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | MBD1 monoclonal antibody (M02), clone 2C7. Western Blot analysis of MBD1 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |