No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00004150-Q01 |
Product name: | MAZ (Human) Recombinant Protein (Q01) |
Product description: | Human MAZ partial ORF ( NP_002374, 332 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 4150 |
Gene name: | MAZ |
Gene alias: | PUR1|Pur-1|SAF-1|SAF-2|ZF87|ZNF801|Zif87 |
Gene description: | MYC-associated zinc finger protein (purine-binding transcription factor) |
Genbank accession: | NM_002383 |
Immunogen sequence/protein sequence: | YQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQ |
Protein accession: | NP_002374 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Loss of Function Thrombospondin-1 Mutations in Familial Pulmonary Hypertension.Maloney JP, Stearman RS, Bull TM, Calabrese DW, Tripp-Addison ML, Wick MJ, Broeckel U, Robbins IM, Wheeler LA, Cogan JD, Loyd JE. Am J Physiol Lung Cell Mol Physiol. 2011 Dec 23. [Epub ahead of print] |