Brand: | Abnova |
Reference: | H00004141-M01 |
Product name: | MARS monoclonal antibody (M01), clone 5G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MARS. |
Clone: | 5G5 |
Isotype: | IgG1 Kappa |
Gene id: | 4141 |
Gene name: | MARS |
Gene alias: | FLJ35667|METRS|MTRNS |
Gene description: | methionyl-tRNA synthetase |
Genbank accession: | NM_004990 |
Immunogen: | MARS (NP_004981, 801 a.a. ~ 899 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKK |
Protein accession: | NP_004981 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MARS monoclonal antibody (M01), clone 5G5 Western Blot analysis of MARS expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |