| Brand: | Abnova |
| Reference: | H00004124-M01 |
| Product name: | MAN2A1 monoclonal antibody (M01), clone 1G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAN2A1. |
| Clone: | 1G9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4124 |
| Gene name: | MAN2A1 |
| Gene alias: | GOLIM7|MANA2|MANII |
| Gene description: | mannosidase, alpha, class 2A, member 1 |
| Genbank accession: | NM_002372 |
| Immunogen: | MAN2A1 (NP_002363, 1045 a.a. ~ 1144 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR |
| Protein accession: | NP_002363 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Quantitative Proteomic Analysis of PCSK9 Gain of Function in Human Hepatic HuH7 Cells.Denis N, Palmer-Smith H, Elisma F, Busuttil A, Wright TG, Khalil MB, Prat A, Seidah NG, Chretien M, Mayne J, Figeys D. J Proteome Res. 2011 Mar 10. [Epub ahead of print] |