| Brand: | Abnova |
| Reference: | H00004123-M01A |
| Product name: | MAN2C1 monoclonal antibody (M01A), clone 1G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAN2C1. |
| Clone: | 1G12 |
| Isotype: | IgM Kappa |
| Gene id: | 4123 |
| Gene name: | MAN2C1 |
| Gene alias: | DKFZp686E23167|MAN6A8|MANA|MANA1|MGC87979 |
| Gene description: | mannosidase, alpha, class 2C, member 1 |
| Genbank accession: | NM_006715 |
| Immunogen: | MAN2C1 (NP_006706.2, 258 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HCHIDTAWLWPFKETVRKCARSWVTALQLMERNPEFIFACSQAQQLEWVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQEFGKMCSE |
| Protein accession: | NP_006706.2 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |