No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00004116-M02 |
Product name: | MAGOH monoclonal antibody (M02), clone 4H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAGOH. |
Clone: | 4H8 |
Isotype: | IgG1 Kappa |
Gene id: | 4116 |
Gene name: | MAGOH |
Gene alias: | MAGOHA |
Gene description: | mago-nashi homolog, proliferation-associated (Drosophila) |
Genbank accession: | NM_002370 |
Immunogen: | MAGOH (NP_002361, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDV |
Protein accession: | NP_002361 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MAGOH monoclonal antibody (M02), clone 4H8 Western Blot analysis of MAGOH expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |