| Brand: | Abnova |
| Reference: | H00004111-M01 |
| Product name: | MAGEA12 monoclonal antibody (M01), clone 3A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAGEA12. |
| Clone: | 3A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4111 |
| Gene name: | MAGEA12 |
| Gene alias: | MAGE12 |
| Gene description: | melanoma antigen family A, 12 |
| Genbank accession: | NM_005367 |
| Immunogen: | MAGEA12 (NP_005358, 70 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVE |
| Protein accession: | NP_005358 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | MAGEA12 monoclonal antibody (M01), clone 3A10. Western Blot analysis of MAGEA12 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |