| Brand: | Abnova |
| Reference: | H00004103-M01 |
| Product name: | MAGEA4 monoclonal antibody (M01), clone 3D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAGEA4. |
| Clone: | 3D12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4103 |
| Gene name: | MAGEA4 |
| Gene alias: | MAGE-41|MAGE-X2|MAGE4|MAGE4A|MAGE4B|MGC21336 |
| Gene description: | melanoma antigen family A, 4 |
| Genbank accession: | NM_002362 |
| Immunogen: | MAGEA4 (NP_002353, 98 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVD |
| Protein accession: | NP_002353 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MAGEA4 monoclonal antibody (M01), clone 3D12 Western Blot analysis of MAGEA4 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Heteroclitic serological response in esophageal and prostate cancer patients after NY-ESO-1 protein vaccination.Kawada J, Wada H, Isobe M, Gnjatic S, Nishikawa H, Jungbluth AA, Okazaki N, Uenaka A, Nakamura Y, Fujiwara S, Mizuno N, Saika T, Ritter E, Yamasaki M, Miyata H, Ritter G, Murphy R, Venhaus R, Pan L, Old LJ, Doki Y, Nakayama E. Int J Cancer. 2011 Mar 16. doi: 10.1002/ijc.26074. [Epub ahead of print] |