No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00004099-M35 |
Product name: | MAG monoclonal antibody (M35), clone 3C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAG. |
Clone: | 3C7 |
Isotype: | IgG1 Kappa |
Gene id: | 4099 |
Gene name: | MAG |
Gene alias: | GMA|S-MAG|SIGLEC-4A|SIGLEC4A |
Gene description: | myelin associated glycoprotein |
Genbank accession: | NM_002361 |
Immunogen: | MAG (NP_002352, 119 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR |
Protein accession: | NP_002352 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MAG monoclonal antibody (M35), clone 3C7. Western Blot analysis of MAG expression in Jurkat(Cat # L017V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |