| Brand: | Abnova |
| Reference: | H00004094-M02 |
| Product name: | MAF monoclonal antibody (M02), clone 6B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAF. |
| Clone: | 6B8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4094 |
| Gene name: | MAF |
| Gene alias: | MGC71685|c-MAF |
| Gene description: | v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) |
| Genbank accession: | NM_005360 |
| Immunogen: | MAF (NP_005351, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK |
| Protein accession: | NP_005351 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | MAF monoclonal antibody (M02), clone 6B8. Western Blot analysis of MAF expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | TACI expression is associated with a mature bone marrow plasma cell signature and C-MAF overexpression in human myeloma cell lines.Moreaux J, Hose D, Jourdan M, Reme T, Hundemer M, Moos M, Robert N, Moine P, De Vos J, Goldschmidt H, Klein B. Haematologica. 2007 Jun;92(6):803-11. |