MAF monoclonal antibody (M01), clone 6B6 View larger

MAF monoclonal antibody (M01), clone 6B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAF monoclonal antibody (M01), clone 6B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about MAF monoclonal antibody (M01), clone 6B6

Brand: Abnova
Reference: H00004094-M01
Product name: MAF monoclonal antibody (M01), clone 6B6
Product description: Mouse monoclonal antibody raised against a partial recombinant MAF.
Clone: 6B6
Isotype: IgG2b Kappa
Gene id: 4094
Gene name: MAF
Gene alias: MGC71685|c-MAF
Gene description: v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian)
Genbank accession: NM_005360
Immunogen: MAF (NP_005351, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Protein accession: NP_005351
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004094-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004094-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MAF is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAF monoclonal antibody (M01), clone 6B6 now

Add to cart