| Brand: | Abnova |
| Reference: | H00004093-M02 |
| Product name: | SMAD9 monoclonal antibody (M02), clone 3E5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SMAD9. |
| Clone: | 3E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4093 |
| Gene name: | SMAD9 |
| Gene alias: | MADH6|MADH9|SMAD8A|SMAD8B |
| Gene description: | SMAD family member 9 |
| Genbank accession: | NM_005905 |
| Immunogen: | SMAD9 (NP_005896, 146 a.a. ~ 260 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVL |
| Protein accession: | NP_005896 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |