Cart 9 Product Products 3 779,44 € (empty)
-
-
-
-
-
-
-
-
1 x APOBEC3A...259,07 € -
No products
To be determined Shipping
3 779,44 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 779,44 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 779,44 €
Data sheet of SMAD7 monoclonal antibody (M07), clone 4G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,S-ELISA,ELISA |
More info about SMAD7 monoclonal antibody (M07), clone 4G11
| Brand: | Abnova |
| Reference: | H00004092-M07 |
| Product name: | SMAD7 monoclonal antibody (M07), clone 4G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMAD7. |
| Clone: | 4G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4092 |
| Gene name: | SMAD7 |
| Gene alias: | CRCS3|FLJ16482|MADH7|MADH8 |
| Gene description: | SMAD family member 7 |
| Genbank accession: | NM_005904 |
| Immunogen: | SMAD7 (NP_005895, 160 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH |
| Protein accession: | NP_005895 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SMAD7 monoclonal antibody (M07), clone 4G11. Western Blot analysis of SMAD7 expression in human ovarian cancer. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |