Brand: | Abnova |
Reference: | H00004091-M06 |
Product name: | SMAD6 monoclonal antibody (M06), clone 2A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SMAD6. |
Clone: | 2A8 |
Isotype: | IgG2a Kappa |
Gene id: | 4091 |
Gene name: | SMAD6 |
Gene alias: | HsT17432|MADH6|MADH7 |
Gene description: | SMAD family member 6 |
Genbank accession: | NM_005585 |
Immunogen: | SMAD6 (NP_005576, 285 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR |
Protein accession: | NP_005576 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged SMAD6 is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |