| Brand: | Abnova |
| Reference: | H00004090-M11 |
| Product name: | SMAD5 monoclonal antibody (M11), clone 1C1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SMAD5. |
| Clone: | 1C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4090 |
| Gene name: | SMAD5 |
| Gene alias: | DKFZp781C1895|DKFZp781O1323|Dwfc|JV5-1|MADH5 |
| Gene description: | SMAD family member 5 |
| Genbank accession: | NM_005903 |
| Immunogen: | SMAD5 (NP_005894, 173 a.a. ~ 268 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEP |
| Protein accession: | NP_005894 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SMAD5 monoclonal antibody (M11), clone 1C1 Western Blot analysis of SMAD5 expression in C32 ( Cat # L002V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |