SMAD5 MaxPab mouse polyclonal antibody (B01) View larger

SMAD5 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMAD5 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SMAD5 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00004090-B01
Product name: SMAD5 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SMAD5 protein.
Gene id: 4090
Gene name: SMAD5
Gene alias: DKFZp781C1895|DKFZp781O1323|Dwfc|JV5-1|MADH5
Gene description: SMAD family member 5
Genbank accession: NM_001001419.1
Immunogen: SMAD5 (NP_001001419.1, 1 a.a. ~ 465 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
Protein accession: NP_001001419.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004090-B01-13-15-1.jpg
Application image note: Western Blot analysis of SMAD5 expression in transfected 293T cell line (H00004090-T01) by SMAD5 MaxPab polyclonal antibody.

Lane 1: SMAD5 transfected lysate(51.15 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SMAD5 MaxPab mouse polyclonal antibody (B01) now

Add to cart