View larger

SMAD3 monoclonal antibody (M21), clone 2G4

Reference:

Condition: New product

Data sheet of SMAD3 monoclonal antibody (M21), clone 2G4

Brand:	Abnova
Reference:	H00004088-M21
Product name:	SMAD3 monoclonal antibody (M21), clone 2G4
Product description:	Mouse monoclonal antibody raised against a full length recombinant SMAD3.
Clone:	2G4
Isotype:	IgG2a Kappa
Gene id:	4088
Gene name:	SMAD3
Gene alias:	DKFZp586N0721\|DKFZp686J10186\|HSPC193\|HsT17436\|JV15-2\|MADH3\|MGC60396
Gene description:	SMAD family member 3
Genbank accession:	NM_005902
Immunogen:	SMAD3 (NP_005893, 147 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	PAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFC
Protein accession:	NP_005893
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (39.27 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Mouse
Application image:
Application image note:	SMAD3 monoclonal antibody (M21), clone 2G4 Western Blot analysis of SMAD3 expression in HeLa ( Cat # L013V1 ).
Applications:	WB-Ce,IF,ELISA,WB-Re
Shipping condition:	Dry Ice