No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,IF,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00004088-M21 |
Product name: | SMAD3 monoclonal antibody (M21), clone 2G4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SMAD3. |
Clone: | 2G4 |
Isotype: | IgG2a Kappa |
Gene id: | 4088 |
Gene name: | SMAD3 |
Gene alias: | DKFZp586N0721|DKFZp686J10186|HSPC193|HsT17436|JV15-2|MADH3|MGC60396 |
Gene description: | SMAD family member 3 |
Genbank accession: | NM_005902 |
Immunogen: | SMAD3 (NP_005893, 147 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFC |
Protein accession: | NP_005893 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (39.27 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | SMAD3 monoclonal antibody (M21), clone 2G4 Western Blot analysis of SMAD3 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |