| Brand: | Abnova |
| Reference: | H00004087-M08 |
| Product name: | SMAD2 monoclonal antibody (M08), clone 3B8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SMAD2. |
| Clone: | 3B8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4087 |
| Gene name: | SMAD2 |
| Gene alias: | JV18|JV18-1|MADH2|MADR2|MGC22139|MGC34440|hMAD-2|hSMAD2 |
| Gene description: | SMAD family member 2 |
| Genbank accession: | NM_005901 |
| Immunogen: | SMAD2 (NP_005892, 16 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSH |
| Protein accession: | NP_005892 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SMAD2 monoclonal antibody (M08), clone 3B8 Western Blot analysis of SMAD2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |