No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00004086-M03 |
| Product name: | SMAD1 monoclonal antibody (M03), clone 2E9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SMAD1. |
| Clone: | 2E9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4086 |
| Gene name: | SMAD1 |
| Gene alias: | BSP1|JV4-1|JV41|MADH1|MADR1 |
| Gene description: | SMAD family member 1 |
| Genbank accession: | BC001878 |
| Immunogen: | SMAD1 (AAH01878.1, 1 a.a. ~ 465 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS |
| Protein accession: | AAH01878.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (76.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Temporal and regional patterns of Smad activation in the rat hippocampus following global ischemia.Nakajima T, Yanagihara M, Nishii H J Neurol Sci. 2013 Nov 19. pii: S0022-510X(13)03041-4. doi: 10.1016/j.jns.2013.11.012. |