No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00004077-M05 |
Product name: | NBR1 monoclonal antibody (M05), clone 5C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NBR1. |
Clone: | 5C3 |
Isotype: | IgG2a Kappa |
Gene id: | 4077 |
Gene name: | NBR1 |
Gene alias: | 1A1-3B|KIAA0049|M17S2|MIG19 |
Gene description: | neighbor of BRCA1 gene 1 |
Genbank accession: | NM_005899 |
Immunogen: | NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV |
Protein accession: | NP_005890 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of NBR1 over-expressed 293 cell line, cotransfected with NBR1 Validated Chimera RNAi ( Cat # H00004077-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NBR1 monoclonal antibody (M05), clone 5C3 (Cat # H00004077-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |