Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 780,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 780,00 €
Data sheet of NBR1 monoclonal antibody (M01), clone 6B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about NBR1 monoclonal antibody (M01), clone 6B11
| Brand: | Abnova |
| Reference: | H00004077-M01 |
| Product name: | NBR1 monoclonal antibody (M01), clone 6B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NBR1. |
| Clone: | 6B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4077 |
| Gene name: | NBR1 |
| Gene alias: | 1A1-3B|KIAA0049|M17S2|MIG19 |
| Gene description: | neighbor of BRCA1 gene 1 |
| Genbank accession: | NM_005899 |
| Immunogen: | NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV |
| Protein accession: | NP_005890 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NBR1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling.Mardakheh FK, Yekezare M, Machesky LM, Heath JK. J Cell Biol. 2009 Oct 12. [Epub ahead of print] |