View larger

NBR1 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of NBR1 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00004077-A01
Product name:	NBR1 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant NBR1.
Gene id:	4077
Gene name:	NBR1
Gene alias:	1A1-3B\|KIAA0049\|M17S2\|MIG19
Gene description:	neighbor of BRCA1 gene 1
Genbank accession:	NM_005899
Immunogen:	NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Protein accession:	NP_005890
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.56 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	p62 and NDP52 target Intracytosolic Shigella and Listeria to different autophagy pathways.Mostowy S, Sancho-Shimizu V, Hamon M, Simeone R, Brosch R, Johansen T, Cossart P. J Biol Chem. 2011 Jun 6. [Epub ahead of print]