Cart 147 Product Products 44 609,91 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Transferri...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x FUNDC2-FUN...113,40 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
265,00 € DAP Shipping
44 874,91 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 147 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 44 609,91 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 44 874,91 €
Data sheet of EPCAM monoclonal antibody (M36), clone 2F34
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about EPCAM monoclonal antibody (M36), clone 2F34
| Brand: | Abnova |
| Reference: | H00004072-M36 |
| Product name: | EPCAM monoclonal antibody (M36), clone 2F34 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPCAM. |
| Clone: | 2F34 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4072 |
| Gene name: | EPCAM |
| Gene alias: | 17-1A|323/A3|CD326|CO-17A|CO17-1A|EGP|EGP-2|EGP34|EGP40|ESA|Ep-CAM|GA733-2|HEA125|KS1/4|KSA|M4S1|MH99|MIC18|MK-1|MOC31|TACST-1|TACSTD1|TROP1|hEGP-2 |
| Gene description: | epithelial cell adhesion molecule |
| Genbank accession: | NM_002354.1 |
| Immunogen: | EPCAM (NP_002345.1, 24 a.a. ~ 265 a.a) partial recombinant protein with his-flag-strepII tag. |
| Immunogen sequence/protein sequence: | QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
| Protein accession: | NP_002345.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (29.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |