Cart 70 Product Products 26 522,71 € (empty)
No products
To be determined Shipping
26 522,71 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 70 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 26 522,71 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 26 522,71 €
Data sheet of EPCAM purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,WB-Tr |
More info about EPCAM purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00004072-B01P |
| Product name: | EPCAM purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human EPCAM protein. |
| Gene id: | 4072 |
| Gene name: | EPCAM |
| Gene alias: | 17-1A|323/A3|CD326|CO-17A|CO17-1A|EGP|EGP-2|EGP34|EGP40|ESA|Ep-CAM|GA733-2|HEA125|KS1/4|KSA|M4S1|MH99|MIC18|MK-1|MOC31|TACST-1|TACSTD1|TROP1|hEGP-2 |
| Gene description: | epithelial cell adhesion molecule |
| Genbank accession: | BC014785 |
| Immunogen: | EPCAM (AAH14785, 1 a.a. ~ 314 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA |
| Protein accession: | AAH14785 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EPCAM MaxPab polyclonal antibody. Western Blot analysis of EPCAM expression in human colon. |
| Applications: | WB-Ti,IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |