Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00004068-B01 |
Product name: | SH2D1A MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human SH2D1A protein. |
Gene id: | 4068 |
Gene name: | SH2D1A |
Gene alias: | DSHP|EBVS|FLJ18687|FLJ92177|IMD5|LYP|MTCP1|SAP|XLP|XLPD |
Gene description: | SH2 domain protein 1A |
Genbank accession: | NM_002351 |
Immunogen: | SH2D1A (NP_002342, 1 a.a. ~ 128 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP |
Protein accession: | NP_002342 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SH2D1A expression in transfected 293T cell line (H00004068-T01) by SH2D1A MaxPab polyclonal antibody. Lane 1: SH2D1A transfected lysate(14.08 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |