Cart 1 Product Products 109,47 € (empty)
No products
To be determined Shipping
109,47 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 109,47 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 109,47 €
Data sheet of LYL1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about LYL1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00004066-B01P |
| Product name: | LYL1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LYL1 protein. |
| Gene id: | 4066 |
| Gene name: | LYL1 |
| Gene alias: | bHLHa18 |
| Gene description: | lymphoblastic leukemia derived sequence 1 |
| Genbank accession: | NM_005583.3 |
| Immunogen: | LYL1 (NP_005574.2, 1 a.a. ~ 280 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR |
| Protein accession: | NP_005574.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LYL1 expression in transfected 293T cell line (H00004066-T01) by LYL1 MaxPab polyclonal antibody. Lane 1: LYL1 transfected lysate(30.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Transcriptional Activation of Prostate Specific Homeobox Gene NKX3-1 in Subsets of T-Cell Lymphoblastic Leukemia (T-ALL).Nagel S, Ehrentraut S, Tomasch J, Lienenklaus S, Schneider B, Geffers R, Meyer C, Kaufmann M, Drexler HG, Macleod RA. PLoS One. 2012;7(7):e40747. Epub 2012 Jul 27. |