Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LY6H monoclonal antibody (M01), clone 3E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about LY6H monoclonal antibody (M01), clone 3E10
| Brand: | Abnova |
| Reference: | H00004062-M01 |
| Product name: | LY6H monoclonal antibody (M01), clone 3E10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant LY6H. |
| Clone: | 3E10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4062 |
| Gene name: | LY6H |
| Gene alias: | NMLY6 |
| Gene description: | lymphocyte antigen 6 complex, locus H |
| Genbank accession: | BC028894 |
| Immunogen: | LY6H (AAH28894, 26 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP |
| Protein accession: | AAH28894 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.39 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 2 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Quantitative profiling of brain lipid raft proteome in a mouse model of fragile x syndrome.Kalinowska M, Castillo C, Francesconi A PLoS One. 2015 Apr 7;10(4):e0121464. doi: 10.1371/journal.pone.0121464. eCollection 2015. |