| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00004060-D01P |
| Product name: | LUM purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human LUM protein. |
| Gene id: | 4060 |
| Gene name: | LUM |
| Gene alias: | LDC|SLRR2D |
| Gene description: | lumican |
| Genbank accession: | NM_002345 |
| Immunogen: | LUM (NP_002336.1, 1 a.a. ~ 338 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN |
| Protein accession: | NP_002336.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of LUM expression in transfected 293T cell line (H00004060-T02) by LUM MaxPab polyclonal antibody. Lane 1: LUM transfected lysate(38.40 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Changes in glycosaminoglycan structure on differentiation of human embryonic stem cells towards mesoderm and endoderm lineages.Gasimli L, Hickey AM, Yang B, Li G, dela Rosa M, Nairn AV, Kulik MJ, Dordick JS, Moremen KW, Dalton S, Linhardt RJ. BBA General Subjects(2014), doi: 10.1016/ j.bbagen.2014.01.007 |