| Brand: | Abnova |
| Reference: | H00004055-M05 |
| Product name: | LTBR monoclonal antibody (M05), clone 5C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LTBR. |
| Clone: | 5C8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4055 |
| Gene name: | LTBR |
| Gene alias: | D12S370|LT-BETA-R|TNF-R-III|TNFCR|TNFR-RP|TNFR2-RP|TNFRSF3 |
| Gene description: | lymphotoxin beta receptor (TNFR superfamily, member 3) |
| Genbank accession: | NM_002342.1 |
| Immunogen: | LTBR (NP_002333.1, 37 a.a. ~ 225 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | ASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTM |
| Protein accession: | NP_002333.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |