Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CYP4F3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CYP4F3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004051-A01 |
| Product name: | CYP4F3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CYP4F3. |
| Gene id: | 4051 |
| Gene name: | CYP4F3 |
| Gene alias: | CPF3|CYP4F|LTB4H |
| Gene description: | cytochrome P450, family 4, subfamily F, polypeptide 3 |
| Genbank accession: | NM_000896 |
| Immunogen: | CYP4F3 (NP_000887, 100 a.a. ~ 198 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM |
| Protein accession: | NP_000887 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | CYP4F3 polyclonal antibody (A01), Lot # UNO2060310QCS1 Western Blot analysis of CYP4F3 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Comparison of toxicity of benzene metabolite hydroquinone in hematopoietic stem cells derived from murine embryonic yolk sac and adult bone marrow.Zhu J, Wang H, Yang S, Guo L, Li Z, Wang W, Wang S, Huang W, Wang L, Yang T, Ma Q, Bi Y PLoS One. 2013 Aug 5;8(8):e71153. doi: 10.1371/journal.pone.0071153. Print 2013. |