| Brand: | Abnova |
| Reference: | H00004049-H01 |
| Product name: | LTA (Human) Recombinant Protein |
| Product description: | Purified LTA (AAH34729.1 58 a.a. - 205 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
| Gene id: | 4049 |
| Gene name: | LTA |
| Gene alias: | LT|TNFB|TNFSF1 |
| Gene description: | lymphotoxin alpha (TNF superfamily, member 1) |
| Genbank accession: | BC034729.1 |
| Immunogen sequence/protein sequence: | HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Protein accession: | AAH34729.1 |
| Form: | Liquid |
| Concentration: | ⥠10 ug/ml |
| Host cell: | Human HEK293T cells |
| Preparation method: | Transfection of pSuper-LTA plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column. |
| Storage buffer: | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | SDS-PAGE and Western Blot |
| Quality control testing picture: |  |
| Tag: | His-Flag-StrepII |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Applications: | WB,ELISA,SDS-PAGE,PI |
| Shipping condition: | Dry Ice |