| Brand: | Abnova |
| Reference: | H00004035-P01 |
| Product name: | LRP1 (Human) Recombinant Protein (P01) |
| Product description: | Human LRP1 full-length ORF ( AAH45107.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 4035 |
| Gene name: | LRP1 |
| Gene alias: | A2MR|APOER|APR|CD91|FLJ16451|IGFBP3R|LRP|MGC88725|TGFBR5 |
| Gene description: | low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor) |
| Genbank accession: | BC045107.1 |
| Immunogen sequence/protein sequence: | MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG |
| Protein accession: | AAH45107.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |