LRP1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

LRP1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRP1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about LRP1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004035-D01P
Product name: LRP1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human LRP1 protein.
Gene id: 4035
Gene name: LRP1
Gene alias: A2MR|APOER|APR|CD91|FLJ16451|IGFBP3R|LRP|MGC88725|TGFBR5
Gene description: low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor)
Genbank accession: BC045107.1
Immunogen: LRP1 (AAH45107.1, 1 a.a. ~ 292 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Protein accession: AAH45107.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004035-D01P-13-15-1.jpg
Application image note: Western Blot analysis of LRP1 expression in transfected 293T cell line (H00004035-T02) by LRP1 MaxPab polyclonal antibody.

Lane 1: LRP1 transfected lysate(31.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LRP1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart