No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00004035-B01P |
Product name: | LRP1 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human LRP1 protein. |
Gene id: | 4035 |
Gene name: | LRP1 |
Gene alias: | A2MR|APOER|APR|CD91|FLJ16451|IGFBP3R|LRP|MGC88725|TGFBR5 |
Gene description: | low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor) |
Genbank accession: | BC045107.1 |
Immunogen: | LRP1 (AAH45107.1, 1 a.a. ~ 292 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG |
Protein accession: | AAH45107.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LRP1 expression in transfected 293T cell line (H00004035-T01) by LRP1 MaxPab polyclonal antibody. Lane 1: LRP1 transfected lysate(32.12 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,IF,WB-Tr |
Shipping condition: | Dry Ice |