Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LOXL2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about LOXL2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004017-A01 |
| Product name: | LOXL2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LOXL2. |
| Gene id: | 4017 |
| Gene name: | LOXL2 |
| Gene alias: | LOR2|WS9-14 |
| Gene description: | lysyl oxidase-like 2 |
| Genbank accession: | NM_002318 |
| Immunogen: | LOXL2 (NP_002309, 675 a.a. ~ 773 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP |
| Protein accession: | NP_002309 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Constitutional Nephrin Deficiency in Conditionally Immortalized Human Podocytes Induced Epithelial-Mesenchymal Transition, Supported by B-Catenin/NF-kappa B Activation: A Consequence of Cell Junction Impairment?Ghiggeri GM, Gigante M, Donato AD. International Journal of Nephrology, vol. 2013, Article ID 457490, 15 pages, 2013. doi:10.1155/2013/457490 |