LOXL2 polyclonal antibody (A01) View larger

LOXL2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOXL2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LOXL2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00004017-A01
Product name: LOXL2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant LOXL2.
Gene id: 4017
Gene name: LOXL2
Gene alias: LOR2|WS9-14
Gene description: lysyl oxidase-like 2
Genbank accession: NM_002318
Immunogen: LOXL2 (NP_002309, 675 a.a. ~ 773 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
Protein accession: NP_002309
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004017-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Constitutional Nephrin Deficiency in Conditionally Immortalized Human Podocytes Induced Epithelial-Mesenchymal Transition, Supported by B-Catenin/NF-kappa B Activation: A Consequence of Cell Junction Impairment?Ghiggeri GM, Gigante M, Donato AD.
International Journal of Nephrology, vol. 2013, Article ID 457490, 15 pages, 2013. doi:10.1155/2013/457490

Reviews

Buy LOXL2 polyclonal antibody (A01) now

Add to cart