Cart 14 Product Products 4 045,98 € (empty)
No products
To be determined Shipping
4 045,98 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 14 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 045,98 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 045,98 €
Data sheet of LOH11CR2A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about LOH11CR2A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004013-A01 |
| Product name: | LOH11CR2A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LOH11CR2A. |
| Gene id: | 4013 |
| Gene name: | VWA5A |
| Gene alias: | BCSC-1|BCSC1|LOH11CR2A |
| Gene description: | von Willebrand factor A domain containing 5A |
| Genbank accession: | NM_198315 |
| Immunogen: | LOH11CR2A (NP_938057, 332 a.a. ~ 415 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR |
| Protein accession: | NP_938057 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.35 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |