Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 054,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 054,00 €
Data sheet of FADS1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about FADS1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003992-A01 |
| Product name: | FADS1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant FADS1. |
| Gene id: | 3992 |
| Gene name: | FADS1 |
| Gene alias: | D5D|FADS6|FADSD5|FLJ38956|FLJ90273|LLCDL1|TU12 |
| Gene description: | fatty acid desaturase 1 |
| Genbank accession: | NM_013402 |
| Immunogen: | FADS1 (NP_037534, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS |
| Protein accession: | NP_037534 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FADS1 polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of FADS1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |