Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00003988-D01P |
Product name: | LIPA purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human LIPA protein. |
Gene id: | 3988 |
Gene name: | LIPA |
Gene alias: | CESD|LAL |
Gene description: | lipase A, lysosomal acid, cholesterol esterase |
Genbank accession: | BC012287.1 |
Immunogen: | LIPA (AAH12287.1, 1 a.a. ~ 399 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ |
Protein accession: | AAH12287.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LIPA expression in transfected 293T cell line (H00003988-T01) by LIPA MaxPab polyclonal antibody. Lane 1: LIPA transfected lysate(45.40 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Characterization of the Niemann-Pick C pathway in alveolar type II cells and lamellar bodies of the lung.Roszell BR, Tao JQ, Yu KJ, Huang S, Bates SR. Am J Physiol Lung Cell Mol Physiol. 2012 May;302(9):L919-32. Epub 2012 Feb 24. |