Cart 16 Product Products 5 659,14 € (empty)
-
1 x ZNF385A-zi...121,50 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
5 659,14 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 16 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 659,14 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 659,14 €
Data sheet of LIPA purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
More info about LIPA purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00003988-D01P |
| Product name: | LIPA purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human LIPA protein. |
| Gene id: | 3988 |
| Gene name: | LIPA |
| Gene alias: | CESD|LAL |
| Gene description: | lipase A, lysosomal acid, cholesterol esterase |
| Genbank accession: | BC012287.1 |
| Immunogen: | LIPA (AAH12287.1, 1 a.a. ~ 399 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ |
| Protein accession: | AAH12287.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LIPA expression in transfected 293T cell line (H00003988-T01) by LIPA MaxPab polyclonal antibody. Lane 1: LIPA transfected lysate(45.40 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Characterization of the Niemann-Pick C pathway in alveolar type II cells and lamellar bodies of the lung.Roszell BR, Tao JQ, Yu KJ, Huang S, Bates SR. Am J Physiol Lung Cell Mol Physiol. 2012 May;302(9):L919-32. Epub 2012 Feb 24. |