No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00003975-M01 |
Product name: | LHX1 monoclonal antibody (M01), clone 4D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LHX1. |
Clone: | 4D1 |
Isotype: | IgG2a Kappa |
Gene id: | 3975 |
Gene name: | LHX1 |
Gene alias: | LIM-1|LIM1|MGC126723|MGC138141 |
Gene description: | LIM homeobox 1 |
Genbank accession: | NM_005568 |
Immunogen: | LHX1 (NP_005559, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST |
Protein accession: | NP_005559 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 0.8 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |