No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003965-A01 |
Product name: | LGALS9 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant LGALS9. |
Gene id: | 3965 |
Gene name: | LGALS9 |
Gene alias: | HUAT|LGALS9A|MGC117375|MGC125973|MGC125974 |
Gene description: | lectin, galactoside-binding, soluble, 9 |
Genbank accession: | NM_009587 |
Immunogen: | LGALS9 (NP_033665, 254 a.a. ~ 355 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT |
Protein accession: | NP_033665 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | LGALS9 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of LGALS9 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Gene and protein expression of galectin-3 and galectin-9 in experimental pneumococcal meningitis.Bellac CL, Coimbra RS, Simon F, Imboden H, Leib SL. Neurobiol Dis. 2007 Nov;28(2):175-83. Epub 2007 Jul 10. |