Cart 221 Product Products 73 289,16 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-GR...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x C1INH...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x NTT5...259,07 € -
-
1 x Septin 2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x ULK3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x ARF6...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Lck...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
73 289,16 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 221 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 73 289,16 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 73 289,16 €
Data sheet of LGALS9 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about LGALS9 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003965-A01 |
| Product name: | LGALS9 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LGALS9. |
| Gene id: | 3965 |
| Gene name: | LGALS9 |
| Gene alias: | HUAT|LGALS9A|MGC117375|MGC125973|MGC125974 |
| Gene description: | lectin, galactoside-binding, soluble, 9 |
| Genbank accession: | NM_009587 |
| Immunogen: | LGALS9 (NP_033665, 254 a.a. ~ 355 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT |
| Protein accession: | NP_033665 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LGALS9 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of LGALS9 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Gene and protein expression of galectin-3 and galectin-9 in experimental pneumococcal meningitis.Bellac CL, Coimbra RS, Simon F, Imboden H, Leib SL. Neurobiol Dis. 2007 Nov;28(2):175-83. Epub 2007 Jul 10. |