Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LFNG monoclonal antibody (M11), clone 1B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA |
More info about LFNG monoclonal antibody (M11), clone 1B6
| Brand: | Abnova |
| Reference: | H00003955-M11 |
| Product name: | LFNG monoclonal antibody (M11), clone 1B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LFNG. |
| Clone: | 1B6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3955 |
| Gene name: | LFNG |
| Gene alias: | SCDO3 |
| Gene description: | LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase |
| Genbank accession: | NM_002304 |
| Immunogen: | LFNG (NP_002295, 1 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVHFWFAT* |
| Protein accession: | NP_002295 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LFNG monoclonal antibody (M11), clone 1B6. Western Blot analysis of LFNG expression in human pancreas. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |